Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MINPP1 Peptide - C-terminal region

MINPP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp564L2016, HIPER1, MINPP2, MIPP

UniProt

Q9UNW1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MINPP1 Rabbit Polyclonal Antibody (orb586443) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004888

Preservative

Lyophilized powder

AA Sequence

VPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EFNB3 Protein Vector (Rat) (pPM-C-HA)
PV265576 500 ng

EFNB3 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Viral 136R/Y136 Protein
8976-BR-025 25 µg

Recombinant Viral 136R/Y136 Protein

Sign In for Pricing
View Details
ZBTB25 (Zinc Finger and BTB Domain Containing 25, KUP, ZNF46) (PE)
MBS6186692-01 0.1 mL

ZBTB25 (Zinc Finger and BTB Domain Containing 25, KUP, ZNF46) (PE)

Sign In for Pricing
View Details
ZBTB25 (Zinc Finger and BTB Domain Containing 25, KUP, ZNF46) (PE)
MBS6186692-02 5x 0.1 mL

ZBTB25 (Zinc Finger and BTB Domain Containing 25, KUP, ZNF46) (PE)

Sign In for Pricing
View Details
Polyclonal Antibody to Claudin 1 (CLDN1)
MBS2112221-01 0.1 mL

Polyclonal Antibody to Claudin 1 (CLDN1)

Sign In for Pricing
View Details
Polyclonal Antibody to Claudin 1 (CLDN1)
MBS2112221-02 0.2 mL

Polyclonal Antibody to Claudin 1 (CLDN1)

Sign In for Pricing
View Details