Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITIH5 Peptide - N-terminal region

ITIH5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686F0145, MGC10848, pp14776, ITI-HC5, PP14776

UniProt

G5E9D8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITIH5 Rabbit Polyclonal Antibody (orb586487) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001001851

Preservative

Lyophilized powder

AA Sequence

ASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CD8 Antibody (Anti-CD8) ELISA Kit
MBS109334-01 48 Well

Mouse CD8 Antibody (Anti-CD8) ELISA Kit

Sign In for Pricing
View Details
Mouse CD8 Antibody (Anti-CD8) ELISA Kit
MBS109334-02 96 Well

Mouse CD8 Antibody (Anti-CD8) ELISA Kit

Sign In for Pricing
View Details
Mouse CD8 Antibody (Anti-CD8) ELISA Kit
MBS109334-03 5x 96 Well

Mouse CD8 Antibody (Anti-CD8) ELISA Kit

Sign In for Pricing
View Details
Mouse CD8 Antibody (Anti-CD8) ELISA Kit
MBS109334-04 10x 96 Well

Mouse CD8 Antibody (Anti-CD8) ELISA Kit

Sign In for Pricing
View Details
Olr1358 (NM_214822) Rat Tagged ORF Clone Lentiviral Particle
RR215310L3V 200 µL

Olr1358 (NM_214822) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
P-c Myc (T58) Antibody, mAb, Rabbit
A03013-50 50 µL

P-c Myc (T58) Antibody, mAb, Rabbit

Sign In for Pricing
View Details