Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITIH5 Peptide - N-terminal region

ITIH5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686F0145, MGC10848, pp14776, ITI-HC5, PP14776

UniProt

Q86UX2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITIH5 Rabbit Polyclonal Antibody (orb586488) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_085046

Preservative

Lyophilized powder

AA Sequence

AAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eukaryotic Vascular Endothelial Growth Factor A (VEGFA)
TRV-0004329-01 10 µg

Eukaryotic Vascular Endothelial Growth Factor A (VEGFA)

Sign In for Pricing
View Details
Eukaryotic Vascular Endothelial Growth Factor A (VEGFA)
TRV-0004329-02 50 µg

Eukaryotic Vascular Endothelial Growth Factor A (VEGFA)

Sign In for Pricing
View Details
Eukaryotic Vascular Endothelial Growth Factor A (VEGFA)
TRV-0004329-03 100 µg

Eukaryotic Vascular Endothelial Growth Factor A (VEGFA)

Sign In for Pricing
View Details
Eukaryotic Vascular Endothelial Growth Factor A (VEGFA)
TRV-0004329-04 200 µg

Eukaryotic Vascular Endothelial Growth Factor A (VEGFA)

Sign In for Pricing
View Details
Eukaryotic Vascular Endothelial Growth Factor A (VEGFA)
TRV-0004329-05 500 µg

Eukaryotic Vascular Endothelial Growth Factor A (VEGFA)

Sign In for Pricing
View Details
Eukaryotic Vascular Endothelial Growth Factor A (VEGFA)
TRV-0004329-06 1 mg

Eukaryotic Vascular Endothelial Growth Factor A (VEGFA)

Sign In for Pricing
View Details