Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT85 Peptide - N-terminal region

KRT85 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HB5, Hb-5, KRTHB5, hHb5

UniProt

P78386

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT85 Rabbit Polyclonal Antibody (orb586491) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002274

Preservative

Lyophilized powder

AA Sequence

CGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNSRFAAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Conjugated Goat Polyclonal Antibody to Human IgE
FA-2104-2 2 mL

FITC Conjugated Goat Polyclonal Antibody to Human IgE

Sign In for Pricing
View Details
RGL2 Antibody
OC-136-01 50 μL

RGL2 Antibody

Sign In for Pricing
View Details
RGL2 Antibody
OC-136-02 100 µL

RGL2 Antibody

Sign In for Pricing
View Details
RGL2 Antibody
OC-136-03 1 mL

RGL2 Antibody

Sign In for Pricing
View Details
Alpha B Crystallin (CRYAB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G1]
TA500590BM 100 µL

Alpha B Crystallin (CRYAB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G1]

Sign In for Pricing
View Details
Deoxy Arteether
TRC-D232110-2MG 2 mg

Deoxy Arteether

Sign In for Pricing
View Details