Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT85 Peptide - N-terminal region

KRT85 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HB5, Hb-5, KRTHB5, hHb5

UniProt

P78386

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT85 Rabbit Polyclonal Antibody (orb586491) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002274

Preservative

Lyophilized powder

AA Sequence

CGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNSRFAAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kv1.2 (KCNA2) (NM_004974) Human Over-expression Lysate
LC401550 20 µg

Kv1.2 (KCNA2) (NM_004974) Human Over-expression Lysate

Sign In for Pricing
View Details
Rpgr Mouse Gene Knockout Kit (CRISPR)
KN515005 1 Kit

Rpgr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ubr2 Mouse Gene Knockout Kit (CRISPR)
KN518620 1 Kit

Ubr2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FITC Anti-Mouse CD25 Antibody[PC-61.5.3]
E-AB-F1102C-01 50 Tests

FITC Anti-Mouse CD25 Antibody[PC-61.5.3]

Sign In for Pricing
View Details
FITC Anti-Mouse CD25 Antibody[PC-61.5.3]
E-AB-F1102C-02 100 Tests

FITC Anti-Mouse CD25 Antibody[PC-61.5.3]

Sign In for Pricing
View Details
FITC Anti-Mouse CD25 Antibody[PC-61.5.3]
E-AB-F1102C-03 2x 100 Tests

FITC Anti-Mouse CD25 Antibody[PC-61.5.3]

Sign In for Pricing
View Details