Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MS4A7 Peptide - middle region

MS4A7 Peptide - middle region

Product Specifications

Product Name Alternative

4SPAN2, CD20L4, CFFM4, MGC22368, MS4A8

UniProt

Q9GZW8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MS4A7 Rabbit Polyclonal Antibody (orb586496) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067024

Preservative

Lyophilized powder

AA Sequence

TGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAFAH1B2 (S64) (PAFAH1B2, PAFAHB, Platelet-activating factor acetylhydrolase IB subunit beta, PAF acetylhydrolase 30kD subunit, PAF-AH subunit beta) (MaxLight 405) discontinued
039610-ML405 100 µL

PAFAH1B2 (S64) (PAFAH1B2, PAFAHB, Platelet-activating factor acetylhydrolase IB subunit beta, PAF acetylhydrolase 30kD subunit, PAF-AH subunit beta) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rat Lrp1b Pre-designed siRNA Set B
SI207780B 1 Each

Rat Lrp1b Pre-designed siRNA Set B

Sign In for Pricing
View Details
GSTA3 Recombinant Rabbit mAb
BS45434-01 50 µL

GSTA3 Recombinant Rabbit mAb

Sign In for Pricing
View Details
GSTA3 Recombinant Rabbit mAb
BS45434-02 100 µL

GSTA3 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Rabbit anti-VPS26B Antibody
MBS4509000-01 0.05 mL

Rabbit anti-VPS26B Antibody

Sign In for Pricing
View Details
Rabbit anti-VPS26B Antibody
MBS4509000-02 0.1 mL

Rabbit anti-VPS26B Antibody

Sign In for Pricing
View Details