Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MS4A7 Peptide - middle region

MS4A7 Peptide - middle region

Product Specifications

Product Name Alternative

4SPAN2, CD20L4, CFFM4, MGC22368, MS4A8

UniProt

Q9GZW8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MS4A7 Rabbit Polyclonal Antibody (orb586496) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067024

Preservative

Lyophilized powder

AA Sequence

TGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia fergusonii UPF0434 protein ycaR (ycaR)
MBS1235090-01 0.02 mg (E-Coli)

Recombinant Escherichia fergusonii UPF0434 protein ycaR (ycaR)

Sign In for Pricing
View Details
Recombinant Escherichia fergusonii UPF0434 protein ycaR (ycaR)
MBS1235090-02 0.1 mg (E-Coli)

Recombinant Escherichia fergusonii UPF0434 protein ycaR (ycaR)

Sign In for Pricing
View Details
Recombinant Escherichia fergusonii UPF0434 protein ycaR (ycaR)
MBS1235090-03 0.02 mg (Yeast)

Recombinant Escherichia fergusonii UPF0434 protein ycaR (ycaR)

Sign In for Pricing
View Details
Recombinant Escherichia fergusonii UPF0434 protein ycaR (ycaR)
MBS1235090-04 0.1 mg (Yeast)

Recombinant Escherichia fergusonii UPF0434 protein ycaR (ycaR)

Sign In for Pricing
View Details
Recombinant Escherichia fergusonii UPF0434 protein ycaR (ycaR)
MBS1235090-05 0.02 mg (Baculovirus)

Recombinant Escherichia fergusonii UPF0434 protein ycaR (ycaR)

Sign In for Pricing
View Details
Recombinant Escherichia fergusonii UPF0434 protein ycaR (ycaR)
MBS1235090-06 1 mg (E-Coli)

Recombinant Escherichia fergusonii UPF0434 protein ycaR (ycaR)

Sign In for Pricing
View Details