Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYCT1 Peptide - middle region

MYCT1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ21269, MGC156309, MGC156310, MTLC

UniProt

Q8N699

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MYCT1 Rabbit Polyclonal Antibody (orb586497) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079383

Preservative

Lyophilized powder

AA Sequence

RRRRASAPISQWSSSRRSRSSYTHGLNRTGFYRHSGCERRSNLSLASLTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rftn2 Mouse shRNA Plasmid (Locus ID 74013)
TL504882 1 Kit

Rftn2 Mouse shRNA Plasmid (Locus ID 74013)

Sign In for Pricing
View Details
Yersinia enterocolitica O:8 Antigen
PR-BA13808-L 1 mg

Yersinia enterocolitica O:8 Antigen

Sign In for Pricing
View Details
SLCO4C1 (NM_180991) Human Over-expression Lysate
LY403616 100 µg

SLCO4C1 (NM_180991) Human Over-expression Lysate

Sign In for Pricing
View Details
TL02-59
BA2825-1 1 mg

TL02-59

Sign In for Pricing
View Details
Quick Step Mouse Estriol, E3 ELISA Kit
QS0211Mo-01 48 Tests

Quick Step Mouse Estriol, E3 ELISA Kit

Sign In for Pricing
View Details
Quick Step Mouse Estriol, E3 ELISA Kit
QS0211Mo-02 96 Tests

Quick Step Mouse Estriol, E3 ELISA Kit

Sign In for Pricing
View Details