Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPFIA4 Peptide - N-terminal region

PPFIA4 Peptide - N-terminal region

Product Specifications

UniProt

O75335

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPFIA4 Rabbit Polyclonal Antibody (orb586506) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055868

Preservative

Lyophilized powder

AA Sequence

AQDLDRMGVMTLPSDLRKHRRKLLSPVSREENREDKATIKCETSPPSSPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Triphenylsilylamine
TRC-T809085-250MG 250 mg

Triphenylsilylamine

Sign In for Pricing
View Details
MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3046), 0.2mg/mL
BNUB3046-500 1x 500 µL

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3046), 0.2mg/mL

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (3H9), CF647 conjugate, 0.1mg/mL
BNC470242-500 1x 500 µL

PTH / Parathyroid Hormone (N-Terminal) (3H9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CYP2F1 (C-term) Rabbit Polyclonal Antibody
AP14733PU-N 400 µL

CYP2F1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ammonium Dichromate
TRC-A633980-50G 50 g

Ammonium Dichromate

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS800554 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details