Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPFIA4 Peptide - N-terminal region

PPFIA4 Peptide - N-terminal region

Product Specifications

UniProt

O75335

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPFIA4 Rabbit Polyclonal Antibody (orb586506) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055868

Preservative

Lyophilized powder

AA Sequence

AQDLDRMGVMTLPSDLRKHRRKLLSPVSREENREDKATIKCETSPPSSPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Clcn3 activation kit by CRISPRa
GA200746 1 Kit

Mouse Clcn3 activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-CK2 beta | Casein kinase 2 subunit beta
AS16 3213 1 Each

Anti-CK2 beta | Casein kinase 2 subunit beta

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.10), CF405S conjugate, 0.1mg/mL
BNC040848-500 1x 500 µL

CD31 / PECAM-1 (C31.10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoD1 (MYD712), CF640R conjugate, 0.1mg/mL
BNC400712-100 1x 100 µL

MyoD1 (MYD712), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Reep1 Mouse Gene Knockout Kit (CRISPR)
KN514642 1 Kit

Reep1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PI 3 Kinase catalytic subunit alpha (PIK3CA) Human Gene Knockout Kit (CRISPR)
KN213112RB 1 Kit

PI 3 Kinase catalytic subunit alpha (PIK3CA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details