SCUBE3 Peptide - N-terminal region
SCUBE3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CEGF3, DKFZp686B09105, DKFZp686B1223, DKFZp686D20108, FLJ34743
UniProt
Q8IX30
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SCUBE3 Rabbit Polyclonal Antibody (orb586515) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
BAC03798
Preservative
Lyophilized powder
AA Sequence
MNCMNKNHGCAHICRETPKGGIACECRPGFELTKNQRDCKLTCNYGNGGC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC700470-500 1x 500 µL
CD45 / LCA (2B11), CF770 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC402499 20 µg
PSF2 (GINS2) (NM_016095) Human Over-expression Lysate
Sign In for Pricing
View Details 
PKSV030144 100 µg
Recombinant EBOV (subtype Sudan, strain Gulu) GP1 / Glycoprotein Protein (His Tag)
Sign In for Pricing
View Details 