Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCUBE3 Peptide - N-terminal region

SCUBE3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CEGF3, DKFZp686B09105, DKFZp686B1223, DKFZp686D20108, FLJ34743

UniProt

Q8IX30

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCUBE3 Rabbit Polyclonal Antibody (orb586515) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

BAC03798

Preservative

Lyophilized powder

AA Sequence

MNCMNKNHGCAHICRETPKGGIACECRPGFELTKNQRDCKLTCNYGNGGC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rho/Rac Guanine Nucleotide Exchange Factor 2 (Ab-885) Antibody
8B1233-AAT 50 µg

Rho/Rac Guanine Nucleotide Exchange Factor 2 (Ab-885) Antibody

Sign In for Pricing
View Details
MIR1299 Human qPCR Primer Pair (MI0006359)
HP300127 200 Reactions

MIR1299 Human qPCR Primer Pair (MI0006359)

Sign In for Pricing
View Details
N-Butylbenzenesulfonamide-d9
TRC-B692392-1MG 1 mg

N-Butylbenzenesulfonamide-d9

Sign In for Pricing
View Details
CDKL1 Mouse Monoclonal Antibody [Clone ID: OTI1H4]
CF805785 100 µg

CDKL1 Mouse Monoclonal Antibody [Clone ID: OTI1H4]

Sign In for Pricing
View Details
Di-tert-butyl Phosphite
TRC-D429515-5G 5 g

Di-tert-butyl Phosphite

Sign In for Pricing
View Details
RNF14 (NM_183400) Human Recombinant Protein
TP323362L 1 mg

RNF14 (NM_183400) Human Recombinant Protein

Sign In for Pricing
View Details