Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC13A4 Peptide - middle region

SLC13A4 Peptide - middle region

Product Specifications

Product Name Alternative

SUT-1, SUT1

UniProt

Q9UKG4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC13A4 Rabbit Polyclonal Antibody (orb586516) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036582

Preservative

Lyophilized powder

AA Sequence

NPIKTANQHQGKKQHPSQEKPQVLTPSPRKQKLNRKYRSHHDQMICKCLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibin Beta A (INHBA, EDF, FRP) (MaxLight 750)
MBS6422743-01 0.1 mL

Inhibin Beta A (INHBA, EDF, FRP) (MaxLight 750)

Sign In for Pricing
View Details
Inhibin Beta A (INHBA, EDF, FRP) (MaxLight 750)
MBS6422743-02 5x 0.1 mL

Inhibin Beta A (INHBA, EDF, FRP) (MaxLight 750)

Sign In for Pricing
View Details
XYD049
E5854-25mg 25 mg

XYD049

Sign In for Pricing
View Details
Human ATP-sensitive inward rectifier potassium channel 10 (KCNJ10)
CSB-EP012048HU-01 10 µg

Human ATP-sensitive inward rectifier potassium channel 10 (KCNJ10)

Sign In for Pricing
View Details
Human ATP-sensitive inward rectifier potassium channel 10 (KCNJ10)
CSB-EP012048HU-02 50 µg

Human ATP-sensitive inward rectifier potassium channel 10 (KCNJ10)

Sign In for Pricing
View Details
Human ATP-sensitive inward rectifier potassium channel 10 (KCNJ10)
CSB-EP012048HU-03 100 µg

Human ATP-sensitive inward rectifier potassium channel 10 (KCNJ10)

Sign In for Pricing
View Details