Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMAP2 Peptide - C-terminal region

SMAP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP1-228H13.3, SMAP1L

UniProt

Q8WU79

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SMAP2 Rabbit Polyclonal Antibody (orb586518) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_073570

Preservative

Lyophilized powder

AA Sequence

KVVGSMPTAGSAGSVPENLNLFPEPGSKSEEIGKKQLSKDSILSLYGSQT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHPT1 Antibody (C-term)
E45R05056G-4 50 µL

PHPT1 Antibody (C-term)

Sign In for Pricing
View Details
Mouse Prion Protein ELISA Kit (PRNP)
RK03137 96 Tests

Mouse Prion Protein ELISA Kit (PRNP)

Sign In for Pricing
View Details
RAB1A Antibody
GWB-MU394G 50 µg

RAB1A Antibody

Sign In for Pricing
View Details
Fecal Occult Positive Stool Sample, Human Patient Sample
MBS170473 Inquire

Fecal Occult Positive Stool Sample, Human Patient Sample

Sign In for Pricing
View Details
Vezt (NM_172538) Mouse Untagged Clone
MC205079 10 µg

Vezt (NM_172538) Mouse Untagged Clone

Sign In for Pricing
View Details
Lentiviral mouse Cphx2 shRNA (UAS) - Lentiviral mouse Cphx2 shRNA (UAS, iRFP) (25)
GTR15225746 1 Vial

Lentiviral mouse Cphx2 shRNA (UAS) - Lentiviral mouse Cphx2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details