Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMAP2 Peptide - C-terminal region

SMAP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP1-228H13.3, SMAP1L

UniProt

Q8WU79

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SMAP2 Rabbit Polyclonal Antibody (orb586518) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_073570

Preservative

Lyophilized powder

AA Sequence

KVVGSMPTAGSAGSVPENLNLFPEPGSKSEEIGKKQLSKDSILSLYGSQT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ednra (NM_010332) Mouse Tagged ORF Clone Lentiviral Particle
MR206815L4V 200 µL

Ednra (NM_010332) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Tert-Butyl 3- (4-fluorophenyl) morpholine-4-carboxylate
JBD33732-01 50 mg

Tert-Butyl 3- (4-fluorophenyl) morpholine-4-carboxylate

Sign In for Pricing
View Details
Tert-Butyl 3- (4-fluorophenyl) morpholine-4-carboxylate
JBD33732-02 0.5 g

Tert-Butyl 3- (4-fluorophenyl) morpholine-4-carboxylate

Sign In for Pricing
View Details
Tjap1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4704805 3x 1.0 µg

Tjap1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Rat IgM (H+L) Secondary Antibody [DyLight 405]
NBP2-68494V 0.5 mL

Goat Polyclonal Goat anti-Rat IgM (H+L) Secondary Antibody [DyLight 405]

Sign In for Pricing
View Details
Rabbit PLCL2 Antibody
orb1522611-01 10 µL

Rabbit PLCL2 Antibody

Sign In for Pricing
View Details