Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

D2HGDH Peptide - C-terminal region

D2HGDH Peptide - C-terminal region

Product Specifications

Product Name Alternative

D2HGD, FLJ42195, MGC25181

UniProt

Q8N465

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with D2HGDH Rabbit Polyclonal Antibody (orb586539) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689996

Preservative

Lyophilized powder

AA Sequence

QESPFYVLIETSGSNAGHDAEKLGHFLEHALGSGLVTDGTMATDQRKVKM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Customized A Antibody
orb818072 2 mg

Customized A Antibody

Sign In for Pricing
View Details
Nhp2l1 siRNA Oligos set (Rat)
31816176 3x 5 nmol

Nhp2l1 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Isochlorogenic acid C
C13884 1 mg

Isochlorogenic acid C

Sign In for Pricing
View Details
Phytic acid dipotassium salt
GC4746-5g 5 g

Phytic acid dipotassium salt

Sign In for Pricing
View Details
Streptococcus Pneumoniae
474328 100 µL

Streptococcus Pneumoniae

Sign In for Pricing
View Details
Krt18 (NM_053976) Rat Tagged ORF Clone Lentiviral Particle
RR211208L3V 200 µL

Krt18 (NM_053976) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details