Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

D2HGDH Peptide - C-terminal region

D2HGDH Peptide - C-terminal region

Product Specifications

Product Name Alternative

D2HGD, FLJ42195, MGC25181

UniProt

Q8N465

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with D2HGDH Rabbit Polyclonal Antibody (orb586539) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689996

Preservative

Lyophilized powder

AA Sequence

QESPFYVLIETSGSNAGHDAEKLGHFLEHALGSGLVTDGTMATDQRKVKM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PDGF beta/PDGFB Antibody Picoband® Fluoro550 Conjugated
PB9311-Fluoro550 100 µg/Vial

Anti-PDGF beta/PDGFB Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Recombinant Purified Human Apolipoprotein E2 protein
APOE25-R 100 µg

Recombinant Purified Human Apolipoprotein E2 protein

Sign In for Pricing
View Details
Rat RBM22 siRNA
abx931046-01 15 nmol

Rat RBM22 siRNA

Sign In for Pricing
View Details
Rat RBM22 siRNA
abx931046-02 30 nmol

Rat RBM22 siRNA

Sign In for Pricing
View Details
Anti-Zebrafish PSMD7 Antibody Picoband® APC Conjugated
AZQ7ZYX7-APC 100 µg/Vial

Anti-Zebrafish PSMD7 Antibody Picoband® APC Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal AMPK beta 1 Antibody
NBP2-92961-0.1mL 0.1 mL

Rabbit Polyclonal AMPK beta 1 Antibody

Sign In for Pricing
View Details