Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

D2HGDH Peptide - C-terminal region

D2HGDH Peptide - C-terminal region

Product Specifications

Product Name Alternative

D2HGD, FLJ42195, MGC25181

UniProt

Q8N465

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with D2HGDH Rabbit Polyclonal Antibody (orb586539) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689996

Preservative

Lyophilized powder

AA Sequence

QESPFYVLIETSGSNAGHDAEKLGHFLEHALGSGLVTDGTMATDQRKVKM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

β-Amyloid, NT Peptide
A2275-55 1 mg

β-Amyloid, NT Peptide

Sign In for Pricing
View Details
OR2B11 Antibody
E51A12149 100 µL

OR2B11 Antibody

Sign In for Pricing
View Details
Recombinant Shigella Dysenteriae frsA Protein (aa 1-414)
VAng-Lsx06867-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Dysenteriae frsA Protein (aa 1-414)

Sign In for Pricing
View Details
Human Galanin (GAL) CLIA Kit
abx190153-01 96 Tests

Human Galanin (GAL) CLIA Kit

Sign In for Pricing
View Details
Human Galanin (GAL) CLIA Kit
abx190153-02 5x 96 Tests

Human Galanin (GAL) CLIA Kit

Sign In for Pricing
View Details
Human Galanin (GAL) CLIA Kit
abx190153-03 10x 96 Tests

Human Galanin (GAL) CLIA Kit

Sign In for Pricing
View Details