Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNG3 Peptide - middle region

GNG3 Peptide - middle region

Product Specifications

UniProt

P63215

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GNG3 Rabbit Polyclonal Antibody (orb326598) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036334

Preservative

Lyophilized powder

AA Sequence

IEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UQCRC2 Recombinant Rabbit Monoclonal Antibody [JE32-56]
HA721872 100 µL

UQCRC2 Recombinant Rabbit Monoclonal Antibody [JE32-56]

Sign In for Pricing
View Details
SERPING1 (NM_001032295) Human Over-expression Lysate
LY422304 100 µg

SERPING1 (NM_001032295) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant c-Fos Antibody
RC-16941-01 50 μL

Recombinant c-Fos Antibody

Sign In for Pricing
View Details
Recombinant c-Fos Antibody
RC-16941-02 100 µL

Recombinant c-Fos Antibody

Sign In for Pricing
View Details
Recombinant c-Fos Antibody
RC-16941-03 1 mL

Recombinant c-Fos Antibody

Sign In for Pricing
View Details
Simetryn
TRC-S485070-250MG 250 mg

Simetryn

Sign In for Pricing
View Details