GNG3 Peptide - middle region
GNG3 Peptide - middle region
Product Specifications
UniProt
P63215
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GNG3 Rabbit Polyclonal Antibody (orb326598) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_036334
Preservative
Lyophilized powder
AA Sequence
IEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY434282 100 µg
SLC6A13 (NM_001190997) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC882792-100 1x 100 µL
Cathepsin K (Marker of Tumor Invasiveness) (CTSK/2792), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![PRMT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B3]](https://cdn.genprice.uk/products/937/68dd1b6c061270361ea168d7/imageurl/ta503588am.webp)
TA503588AM 100 µL
PRMT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B3]
Sign In for Pricing
View Details 
![GNMT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8A3]](https://cdn.genprice.uk/products/937/6868c31a994c49e6dc3ef5d7/imageurl/ta501276am.webp)
TA501276AM 100 µL
GNMT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8A3]
Sign In for Pricing
View Details