Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRF2BP2 Peptide - C-terminal region

IRF2BP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC72189

UniProt

Q7Z5L9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IRF2BP2 Rabbit Polyclonal Antibody (orb331351) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001070865

Preservative

Lyophilized powder

AA Sequence

LILVADNAGGSHASKDANQVHSTTRRNSNSPPSPSSMNQRRLGPREVGGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SPEN shRNA (UAS) - Lentiviral human SPEN shRNA (UAS, GFP) plasmid
GTR15083578 1 Vial

Lentiviral human SPEN shRNA (UAS) - Lentiviral human SPEN shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Human TMEM118 (RNFT2) (NM_001109903) AAV Particle
RC225729A1V 250 µL

Human TMEM118 (RNFT2) (NM_001109903) AAV Particle

Sign In for Pricing
View Details
Recombinant Human DDX43 Protein - (Dry Ice)
H00055510-P01-2ug 2 µg

Recombinant Human DDX43 Protein - (Dry Ice)

Sign In for Pricing
View Details
PCNA Rabbit mAb
E45R13105N-50 50 µL

PCNA Rabbit mAb

Sign In for Pricing
View Details
Sept6 (BC010489) Mouse Tagged Lenti ORF Clone
MR206812L4 10 µg

Sept6 (BC010489) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Goat Nicotinamide Adenine Dinucleotide Phosphate ELISA Kit
MBS006254 Inquire

Goat Nicotinamide Adenine Dinucleotide Phosphate ELISA Kit

Sign In for Pricing
View Details