Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRF2BP2 Peptide - C-terminal region

IRF2BP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC72189

UniProt

Q7Z5L9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IRF2BP2 Rabbit Polyclonal Antibody (orb331351) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001070865

Preservative

Lyophilized powder

AA Sequence

LILVADNAGGSHASKDANQVHSTTRRNSNSPPSPSSMNQRRLGPREVGGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2310061N02Rik CRISPRa sgRNA lentivector (set of three targets)(Mouse)
10414124 3x 1.0µg DNA

2310061N02Rik CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Rabbit Monoclonal PRMT7 Antibody (S06-4F6)
NBP3-15083-100ul 100 µL

Rabbit Monoclonal PRMT7 Antibody (S06-4F6)

Sign In for Pricing
View Details
Sheep COX assembly mitochondrial protein homolog (CMC1) ELISA Kit
GTR10363049 96 Well

Sheep COX assembly mitochondrial protein homolog (CMC1) ELISA Kit

Sign In for Pricing
View Details
MAGI2 Antibody (Biotin)
orb415168-01 50 µg

MAGI2 Antibody (Biotin)

Sign In for Pricing
View Details
MAGI2 Antibody (Biotin)
orb415168-02 100 µg

MAGI2 Antibody (Biotin)

Sign In for Pricing
View Details
Cdk15 (NM_001033373) Mouse Tagged ORF Clone
MG219984 10 µg

Cdk15 (NM_001033373) Mouse Tagged ORF Clone

Sign In for Pricing
View Details