Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT74 Peptide - N-terminal region

KRT74 Peptide - N-terminal region

Product Specifications

Product Name Alternative

K6IRS4, KRT5C, KRT6IRS4

UniProt

Q7RTS7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT74 Rabbit Polyclonal Antibody (orb586550) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_778223

Preservative

Lyophilized powder

AA Sequence

VCPPGGIHQVTVNKSLLAPLNVELDPEIQKVRAQEREQIKVLNDKFASFI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kallikrein 5 (KLK5) (NM_001077492) Human Over-expression Lysate
LC421443 20 µg

Kallikrein 5 (KLK5) (NM_001077492) Human Over-expression Lysate

Sign In for Pricing
View Details
Spata3 Mouse Gene Knockout Kit (CRISPR)
KN316552RB 1 Kit

Spata3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD40, Mouse (FGK45.5), 1mg/mL
BNUM2005-50 1x 50 µL

CD40, Mouse (FGK45.5), 1mg/mL

Sign In for Pricing
View Details
Recombinant Human GPNMB Protein (Fc Tag)
PDMH100217-01 20 µg

Recombinant Human GPNMB Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human GPNMB Protein (Fc Tag)
PDMH100217-02 100 µg

Recombinant Human GPNMB Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human GPNMB Protein (Fc Tag)
PDMH100217-03 500 µg

Recombinant Human GPNMB Protein (Fc Tag)

Sign In for Pricing
View Details