LPAR6 Peptide - C-terminal region
LPAR6 Peptide - C-terminal region
Product Specifications
Product Name Alternative
LAH3, MGC120358, P2RY5, P2Y5
UniProt
P43657
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LPAR6 Rabbit Polyclonal Antibody (orb586553) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005758
Preservative
Lyophilized powder
AA Sequence
VAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQNSIKMKNWSVRRSDFR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![GM CSF (CSF2) Mouse Monoclonal Antibody [Clone ID: OTI13E6]](https://cdn.genprice.uk/products/937/68dd18b9061270361e90821c/imageurl/cf808007.webp)
CF808007 100 µg
GM CSF (CSF2) Mouse Monoclonal Antibody [Clone ID: OTI13E6]
Sign In for Pricing
View Details 
BNUB3046-100 1x 100 µL
MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3046), 0.2mg/mL
Sign In for Pricing
View Details 
LC419701 20 µg
Carboxypeptidase H (CPE) (NM_001873) Human Over-expression Lysate
Sign In for Pricing
View Details 
AP02532PU-N 100 µL
MEK1 (MAP2K1) pThr292 Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 