Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPAR6 Peptide - C-terminal region

LPAR6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LAH3, MGC120358, P2RY5, P2Y5

UniProt

P43657

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LPAR6 Rabbit Polyclonal Antibody (orb586553) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005758

Preservative

Lyophilized powder

AA Sequence

VAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQNSIKMKNWSVRRSDFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stk32c Mouse Gene Knockout Kit (CRISPR)
KN516880 1 Kit

Stk32c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
APC Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034UE-01 25 µg

APC Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details
APC Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034UE-02 100 µg

APC Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details
SMAP2 (Center) Rabbit Polyclonal Antibody
AP53941PU-N 400 µL

SMAP2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Kappa Light Chain (KLC264), CF647 conjugate, 0.1mg/mL
BNC470264-500 1x 500 µL

Human Kappa Light Chain (KLC264), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 (NM_000591) Human Over-expression Lysate
LY424624 100 µg

CD14 (NM_000591) Human Over-expression Lysate

Sign In for Pricing
View Details