Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKAP Peptide - C-terminal region

NKAP Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ22626

UniProt

Q8N5F7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NKAP Rabbit Polyclonal Antibody (orb586557) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078804

Preservative

Lyophilized powder

AA Sequence

EAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFREMVYRKTKGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal KLHL8 Antibody
NBP2-47406-25ul 25 µL

Rabbit Polyclonal KLHL8 Antibody

Sign In for Pricing
View Details
Palmitoyldocosahexaenoyl phosphatidylcholine
M33053-01 1 g

Palmitoyldocosahexaenoyl phosphatidylcholine

Sign In for Pricing
View Details
Palmitoyldocosahexaenoyl phosphatidylcholine
M33053-02 500 mg

Palmitoyldocosahexaenoyl phosphatidylcholine

Sign In for Pricing
View Details
Palmitoyldocosahexaenoyl phosphatidylcholine
M33053-03 5 mg

Palmitoyldocosahexaenoyl phosphatidylcholine

Sign In for Pricing
View Details
Palmitoyldocosahexaenoyl phosphatidylcholine
M33053-04 10 mg

Palmitoyldocosahexaenoyl phosphatidylcholine

Sign In for Pricing
View Details
Palmitoyldocosahexaenoyl phosphatidylcholine
M33053-05 25 mg

Palmitoyldocosahexaenoyl phosphatidylcholine

Sign In for Pricing
View Details