Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR13G1 Peptide - C-terminal region

OR13G1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR1-37

UniProt

Q8NGZ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR13G1 Rabbit Polyclonal Antibody (orb586562) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005487

Preservative

Lyophilized powder

AA Sequence

STCSSHLTVVTLYYSPVIYTYIRPASSYTFERDKVVAALYTLVTPTLNPM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse F9 (Coagulation Factor IX) ELISA Kit
EKE61572 96 Tests

Mouse F9 (Coagulation Factor IX) ELISA Kit

Sign In for Pricing
View Details
PetA Antibody
PHY0488A 150 μg

PetA Antibody

Sign In for Pricing
View Details
Myf-6 Lentiviral Activation Particles (h2)
sc-401899-LAC-2 200 µL

Myf-6 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Recombinant Human PEPD Protein
ARP3338-01 10 µg

Recombinant Human PEPD Protein

Sign In for Pricing
View Details
Recombinant Human PEPD Protein
ARP3338-02 50 µg

Recombinant Human PEPD Protein

Sign In for Pricing
View Details
Recombinant Human PEPD Protein
ARP3338-03 100 µg

Recombinant Human PEPD Protein

Sign In for Pricing
View Details