Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR13G1 Peptide - C-terminal region

OR13G1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR1-37

UniProt

Q8NGZ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR13G1 Rabbit Polyclonal Antibody (orb586562) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005487

Preservative

Lyophilized powder

AA Sequence

STCSSHLTVVTLYYSPVIYTYIRPASSYTFERDKVVAALYTLVTPTLNPM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTTG (DCS-280) Alexa Fluor® 790
sc-56207 AF790 200 µg/mL

PTTG (DCS-280) Alexa Fluor® 790

Sign In for Pricing
View Details
KRTAP9-6 siRNA (Human)
MBS8207966-01 15 nmol

KRTAP9-6 siRNA (Human)

Sign In for Pricing
View Details
KRTAP9-6 siRNA (Human)
MBS8207966-02 30 nmol

KRTAP9-6 siRNA (Human)

Sign In for Pricing
View Details
KRTAP9-6 siRNA (Human)
MBS8207966-03 5x 30 nmol

KRTAP9-6 siRNA (Human)

Sign In for Pricing
View Details
EXOSC6 sgRNA CRISPR Lentivector (Human) (Target 2)
K0704003 1.0 µg DNA

EXOSC6 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Neuronal Acetylcholine receptor subunit alpha-5 Antibody [D11]
54-336 100 µg

Neuronal Acetylcholine receptor subunit alpha-5 Antibody [D11]

Sign In for Pricing
View Details