PAPLN Peptide - C-terminal region
PAPLN Peptide - C-terminal region
Product Specifications
Product Name Alternative
DKFZp434F053, MGC50452
UniProt
O95428
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PAPLN Rabbit Polyclonal Antibody (orb586564) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_775733
Preservative
Lyophilized powder
AA Sequence
QPISSDRHRLQFDGSLIIHPLQAEDAGTYSCGSTRPGRDSQKIQLRIIGG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TA362141 100 µL
Prune homolog 2 (PRUNE2) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
BNC402345-500 1x 500 µL
CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC683048-100 1x 100 µL
MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3048), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
