Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAPLN Peptide - C-terminal region

PAPLN Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp434F053, MGC50452

UniProt

O95428

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAPLN Rabbit Polyclonal Antibody (orb586564) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775733

Preservative

Lyophilized powder

AA Sequence

QPISSDRHRLQFDGSLIIHPLQAEDAGTYSCGSTRPGRDSQKIQLRIIGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mitochondrial Marker (MTC754), 1mg/mL
BNUM0754-50 1x 50 µL

Mitochondrial Marker (MTC754), 1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Endometrium
CB501228 1 Block

Frozen Tissue Blocks, Endometrium

Sign In for Pricing
View Details
CD4 Monoclonal Antibody
E-AB-22098-01 20 µL

CD4 Monoclonal Antibody

Sign In for Pricing
View Details
CD4 Monoclonal Antibody
E-AB-22098-02 60 µL

CD4 Monoclonal Antibody

Sign In for Pricing
View Details
CD4 Monoclonal Antibody
E-AB-22098-03 120 µL

CD4 Monoclonal Antibody

Sign In for Pricing
View Details
CD4 Monoclonal Antibody
E-AB-22098-04 200 µL

CD4 Monoclonal Antibody

Sign In for Pricing
View Details