Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIP5K1B Peptide - C-terminal region

PIP5K1B Peptide - C-terminal region

Product Specifications

Product Name Alternative

MSS4, STM7

UniProt

O14986

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIP5K1B Rabbit Polyclonal Antibody (orb586565) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003549

Preservative

Lyophilized powder

AA Sequence

VFKKIQALKASPSKKRCNSIAALKATSQEIVSSISQEWKDEKRDLLTEGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phenylacetyl L-Glutamine
TRC-P306500-25MG 25 mg

Phenylacetyl L-Glutamine

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (L452R) (His Tag)
PKSV030334 100 µg

Recombinant SARS-CoV-2 Spike RBD (L452R) (His Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS808803 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
CD45RA (111-1C5), 0.2mg/mL
BNUB1038-500 1x 500 µL

CD45RA (111-1C5), 0.2mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS805550 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
EDG2 Antibody
8G083-AAT 50 µg

EDG2 Antibody

Sign In for Pricing
View Details