Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIP5K1B Peptide - C-terminal region

PIP5K1B Peptide - C-terminal region

Product Specifications

Product Name Alternative

MSS4, STM7

UniProt

O14986

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIP5K1B Rabbit Polyclonal Antibody (orb586565) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003549

Preservative

Lyophilized powder

AA Sequence

VFKKIQALKASPSKKRCNSIAALKATSQEIVSSISQEWKDEKRDLLTEGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S1pr5 Mouse Gene Knockout Kit (CRISPR)
KN515252 1 Kit

S1pr5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EIF4ENIF1 (NM_001164501) Human Over-expression Lysate
LY432079 100 µg

EIF4ENIF1 (NM_001164501) Human Over-expression Lysate

Sign In for Pricing
View Details
2,2',4,4',6,6'-Hexabromo-bibenzyl
TRC-H281405-10MG 10 mg

2,2',4,4',6,6'-Hexabromo-bibenzyl

Sign In for Pricing
View Details
KIF25 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D3]
TA505424AM 100 µL

KIF25 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D3]

Sign In for Pricing
View Details
SLC24A5 (NM_205850) Human Over-expression Lysate
LC404200 20 µg

SLC24A5 (NM_205850) Human Over-expression Lysate

Sign In for Pricing
View Details
MTRF1L Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F11]
TA501065BM 100 µL

MTRF1L Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F11]

Sign In for Pricing
View Details