POF1B Peptide - N-terminal region
POF1B Peptide - N-terminal region
Product Specifications
Product Name Alternative
FLJ22792, POF, POF2B
UniProt
Q8WVV4
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with POF1B Rabbit Polyclonal Antibody (orb586567) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079197
Preservative
Lyophilized powder
AA Sequence
HYHCYHQSSQAQQPPEKNVVYERVRTYSGPMNKVVQALDPFNSREVLSPL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681797-500 1x 500 µL
Histone H1 (Nuclear Marker) (r1415-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
ICH1073-5mg 5 mg
Anti-Mouse CD40 (FGK4.5) In Vivo Antibody - Low Endotoxin
Sign In for Pricing
View Details 
![9-[[9-[(4,4,5,5,5-Pentafluoropentyl)sulfenyl]nonyl]sulfenyl]nonyl Bromide](https://cdn.genprice.uk/products/572/2441567038079/imageurl/trc-p227255-1g.webp)
TRC-P227255-1G 1 g
9-[[9-[(4,4,5,5,5-Pentafluoropentyl)sulfenyl]nonyl]sulfenyl]nonyl Bromide
Sign In for Pricing
View Details