Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POF1B Peptide - N-terminal region

POF1B Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ22792, POF, POF2B

UniProt

Q8WVV4

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POF1B Rabbit Polyclonal Antibody (orb586567) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079197

Preservative

Lyophilized powder

AA Sequence

HYHCYHQSSQAQQPPEKNVVYERVRTYSGPMNKVVQALDPFNSREVLSPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bis(1,3-dichloro-2-propyl) Phosphate-d10
TRC-B419097-1MG 1 mg

Bis(1,3-dichloro-2-propyl) Phosphate-d10

Sign In for Pricing
View Details
Sodium Potassium ATPase (ATP1A1) Rabbit Polyclonal Antibody
AP01364PU-N 100 µg

Sodium Potassium ATPase (ATP1A1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TMEM185A Antibody
8G749-AAT 50 µg

TMEM185A Antibody

Sign In for Pricing
View Details
Biotin PEG4 amine
3013-AAT 5 mg

Biotin PEG4 amine

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/1799R), CF594 conjugate, 0.1mg/mL
BNC941799-100 1x 100 µL

P53 Tumor Suppressor Protein (TP53/1799R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OR5K4 (NM_001005517) Human Over-expression Lysate
LY423620 100 µg

OR5K4 (NM_001005517) Human Over-expression Lysate

Sign In for Pricing
View Details