POF1B Peptide - C-terminal region
POF1B Peptide - C-terminal region
Product Specifications
Product Name Alternative
FLJ22792, POF, POF2B
UniProt
Q8WVV4
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with POF1B Rabbit Polyclonal Antibody (orb586568) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079197
Preservative
Lyophilized powder
AA Sequence
MEKDREICRLRSQLNQYHKDVSKREGSCSDFQFKLHELTSLLEEKDSLIK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881139-500 1x 500 µL
CD66, pan (CEA) (Cocktail), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC883527-500 1x 500 µL
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3527), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![TWO-PRO™ 3 [equivalent to TO-PRO®-3] *5 mM DMSO Solution* *CAS 157199-63-8*](https://cdn.genprice.uk/products/271/7360546/imageurl/17572-aat.webp)
17572-AAT 0.2 mL
TWO-PRO™ 3 [equivalent to TO-PRO®-3] *5 mM DMSO Solution* *CAS 157199-63-8*
Sign In for Pricing
View Details