POF1B Peptide - C-terminal region
POF1B Peptide - C-terminal region
Product Specifications
Product Name Alternative
FLJ22792, POF, POF2B
UniProt
Q8WVV4
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with POF1B Rabbit Polyclonal Antibody (orb586568) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079197
Preservative
Lyophilized powder
AA Sequence
MEKDREICRLRSQLNQYHKDVSKREGSCSDFQFKLHELTSLLEEKDSLIK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP324421 20 µg
Syntrophin (SNTB1) (NM_021021) Human Recombinant Protein
Sign In for Pricing
View Details 
BNC042908-100 1x 100 µL
CD68 (Macrophage Marker) (C68/2908R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUM2149-50 1x 50 µL
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (rKRT16/1714), 1mg/mL
Sign In for Pricing
View Details 