Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPYR1 Peptide - N-terminal region

PPYR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC116897, NPY4-R, NPY4R, PP1, Y4, PPYR1

UniProt

P50391

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPYR1 Rabbit Polyclonal Antibody (orb586569) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005963

Preservative

Lyophilized powder

AA Sequence

LLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC88C (NM_001080414) Human Over-expression Lysate
LC421631 20 µg

CCDC88C (NM_001080414) Human Over-expression Lysate

Sign In for Pricing
View Details
KHDRBS1 Polyclonal Antibody
E-AB-62359-01 60 µL

KHDRBS1 Polyclonal Antibody

Sign In for Pricing
View Details
KHDRBS1 Polyclonal Antibody
E-AB-62359-02 120 µL

KHDRBS1 Polyclonal Antibody

Sign In for Pricing
View Details
KHDRBS1 Polyclonal Antibody
E-AB-62359-03 200 µL

KHDRBS1 Polyclonal Antibody

Sign In for Pricing
View Details
CD30 (TNFRSF8) Mouse Monoclonal Antibody [Clone ID: MEM-268]
AM03094FC-N 100 Tests

CD30 (TNFRSF8) Mouse Monoclonal Antibody [Clone ID: MEM-268]

Sign In for Pricing
View Details
C1QA Rabbit Monoclonal Antibody
TA422465 100 µL

C1QA Rabbit Monoclonal Antibody

Sign In for Pricing
View Details