PPYR1 Peptide - N-terminal region
PPYR1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MGC116897, NPY4-R, NPY4R, PP1, Y4, PPYR1
UniProt
P50391
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPYR1 Rabbit Polyclonal Antibody (orb586569) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005963
Preservative
Lyophilized powder
AA Sequence
LLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882238-100 1x 100 µL
Ezrin / p81 (CPTC-Ezrin-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PKSH030750 100 µg
Recombinant Human Resistin Protein (aa 17-108, Fc Tag)
Sign In for Pricing
View Details 
LY401028 100 µg
Ribonuclease Inhibitor (RNH1) (NM_002939) Human Over-expression Lysate
Sign In for Pricing
View Details 
TP304796L 1 mg
CalmoduLin (CALM2) (NM_001743) Human Recombinant Protein
Sign In for Pricing
View Details 