Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REP15 Peptide - N-terminal region

REP15 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RAB15EP

UniProt

Q6BDI9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with REP15 Rabbit Polyclonal Antibody (orb326603) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001025045

Preservative

Lyophilized powder

AA Sequence

YPPSKLCPAANTLNEIFLIHFITFCQEKGVDEWLTTTKMTKHQAFLFGAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A1874 25mg
A18735-25 25 mg

A1874 25mg

Sign In for Pricing
View Details
Slc9a4 AAV siRNA Pooled Vector
44302166 1.0 µg

Slc9a4 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
IGHVII-53-1 ORF Vector (Human) (pORF)
ORF021603 1.0 µg DNA

IGHVII-53-1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
MAGEC2 Antibody
CSB-PA574003 100 µL

MAGEC2 Antibody

Sign In for Pricing
View Details
MGEA5 sgRNA CRISPR Lentivector set (Human)
K1299101 3x 1.0 µg

MGEA5 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
CCDC191 (NM_020817) Human Tagged ORF Clone
RG221715 10 µg

CCDC191 (NM_020817) Human Tagged ORF Clone

Sign In for Pricing
View Details