Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHC4 Peptide - N-terminal region

SHC4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC34023, RaLP, SHCD

UniProt

Q6S5L8

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHC4 Rabbit Polyclonal Antibody (orb331352) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_976224

Preservative

Lyophilized powder

AA Sequence

NPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSSPETSLSRSGTAPPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMX Rabbit Polyclonal Antibody
AP01173PU-N 100 µg

BMX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EIF3g Recombinant Rabbit monoclonal Antibody
HA751288 100 µL

EIF3g Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Omadacycline carboxamide impurity
TRC-O918255-10MG 10 mg

Omadacycline carboxamide impurity

Sign In for Pricing
View Details
NF-KB p65 (acetyl K314/K315) Antibody
KC-4122-01 50 μL

NF-KB p65 (acetyl K314/K315) Antibody

Sign In for Pricing
View Details
NF-KB p65 (acetyl K314/K315) Antibody
KC-4122-02 100 µL

NF-KB p65 (acetyl K314/K315) Antibody

Sign In for Pricing
View Details
NF-KB p65 (acetyl K314/K315) Antibody
KC-4122-03 1 mL

NF-KB p65 (acetyl K314/K315) Antibody

Sign In for Pricing
View Details