Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHC4 Peptide - N-terminal region

SHC4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC34023, RaLP, SHCD

UniProt

Q6S5L8

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHC4 Rabbit Polyclonal Antibody (orb331352) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_976224

Preservative

Lyophilized powder

AA Sequence

NPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSSPETSLSRSGTAPPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS629192 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Human SCGN activation kit by CRISPRa
GA107247 1 Kit

Human SCGN activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human STAT6 Protein (Baculovirus, His Tag)
PKSH030708 100 µg

Recombinant Human STAT6 Protein (Baculovirus, His Tag)

Sign In for Pricing
View Details
ICOS-L / ICOS Ligand / B7RP-1 (Immuno-Oncology Target) (ICOSL/3111), CF640R conjugate, 0.1mg/mL
BNC403111-100 1x 100 µL

ICOS-L / ICOS Ligand / B7RP-1 (Immuno-Oncology Target) (ICOSL/3111), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chloroacetaldehyde Diethyl Acetal
TRC-C292785-50G 50 g

Chloroacetaldehyde Diethyl Acetal

Sign In for Pricing
View Details
Recombinant Human ACE2 Protein (Sumo Tag)
PDEH100506-01 20 µg

Recombinant Human ACE2 Protein (Sumo Tag)

Sign In for Pricing
View Details