Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPSB1 Peptide - middle region

SPSB1 Peptide - middle region

Product Specifications

Product Name Alternative

SSB-1, SSB1

UniProt

Q96BD6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPSB1 Rabbit Polyclonal Antibody (orb326606) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079382

Preservative

Lyophilized powder

AA Sequence

RGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDL

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parvalbumin (PVALB) Rabbit Polyclonal Antibody
TA322949 100 µL

Parvalbumin (PVALB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TTDA (GTF2H5) (NM_207118) Human Tagged Lenti ORF Clone
RC209579L2 10 µg

TTDA (GTF2H5) (NM_207118) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Mycobacterium smegmatis Alpha-keto-acid decarboxylase (kdc), partial
MBS1108558 Inquire

Recombinant Mycobacterium smegmatis Alpha-keto-acid decarboxylase (kdc), partial

Sign In for Pricing
View Details
PSMA8 Rabbit Polyclonal Antibody (APC)
orb998853 100 µL

PSMA8 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
TAS2R13 Antibody
8G752-AAT 50 µg

TAS2R13 Antibody

Sign In for Pricing
View Details
PYCR2 discontinued
531520-01 20 µL

PYCR2 discontinued

Sign In for Pricing
View Details