Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYTL5 Peptide - middle region

SYTL5 Peptide - middle region

Product Specifications

Product Name Alternative

Slp5

UniProt

Q8TDW5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SYTL5 Rabbit Polyclonal Antibody (orb586577) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

EAW59450

Preservative

Lyophilized powder

AA Sequence

PGAEEVQSQEQTRQDAEKSDTSPVAGKKASHDGPKRKGFLLSKFRSATRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium 4-Chloro-1-hydroxybutanesulfonate
TRC-C585630-2.5G 2.5 g

Sodium 4-Chloro-1-hydroxybutanesulfonate

Sign In for Pricing
View Details
Recombinant Mouse AXL/UFO Protein (Fc Tag)
PDMM100113-01 20 µg

Recombinant Mouse AXL/UFO Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse AXL/UFO Protein (Fc Tag)
PDMM100113-02 100 µg

Recombinant Mouse AXL/UFO Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse AXL/UFO Protein (Fc Tag)
PDMM100113-03 500 µg

Recombinant Mouse AXL/UFO Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse AXL/UFO Protein (Fc Tag)
PDMM100113-04 1 mg

Recombinant Mouse AXL/UFO Protein (Fc Tag)

Sign In for Pricing
View Details
Human Interleukin 12 Receptor Beta 1 (IL12Rb1) ELISA Kit
RD-IL12Rb1-Hu-01 96 Tests

Human Interleukin 12 Receptor Beta 1 (IL12Rb1) ELISA Kit

Sign In for Pricing
View Details