Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYTL5 Peptide - middle region

SYTL5 Peptide - middle region

Product Specifications

Product Name Alternative

Slp5

UniProt

Q8TDW5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SYTL5 Rabbit Polyclonal Antibody (orb586577) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

EAW59450

Preservative

Lyophilized powder

AA Sequence

PGAEEVQSQEQTRQDAEKSDTSPVAGKKASHDGPKRKGFLLSKFRSATRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2491), CF568 conjugate, 0.1mg/mL
BNC682491-500 1x 500 µL

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2491), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS808584 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
gamma Sarcoglycan Recombinant Rabbit Monoclonal Antibody [JA11-57]
ET1704-24 100 µL

gamma Sarcoglycan Recombinant Rabbit Monoclonal Antibody [JA11-57]

Sign In for Pricing
View Details
OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2136), CF488A conjugate, 0.1mg/mL
BNC882136-100 1x 100 µL

OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2136), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FAM86B2 Human Gene Knockout Kit (CRISPR)
KN427831 1 Kit

FAM86B2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Centlein (CNTLN) Human Gene Knockout Kit (CRISPR)
KN423411 1 Kit

Centlein (CNTLN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details