Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBCEL Peptide - C-terminal region

TBCEL Peptide - C-terminal region

Product Specifications

Product Name Alternative

El, FLJ14177, LRRC35, MGC10233

UniProt

Q5QJ74

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBCEL Rabbit Polyclonal Antibody (orb586579) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689928

Preservative

Lyophilized powder

AA Sequence

ISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTS5 discontinued
385401 200 µL

ADAMTS5 discontinued

Sign In for Pricing
View Details
AW146020 sgRNA CRISPR Lentivector set (Mouse)
K3895901 3x 1.0 µg

AW146020 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
GPRC5B Recombinant Rabbit mAb
orb2325791-01 25 µL

GPRC5B Recombinant Rabbit mAb

Sign In for Pricing
View Details
GPRC5B Recombinant Rabbit mAb
orb2325791-02 50 µL

GPRC5B Recombinant Rabbit mAb

Sign In for Pricing
View Details
GPRC5B Recombinant Rabbit mAb
orb2325791-03 100 µL

GPRC5B Recombinant Rabbit mAb

Sign In for Pricing
View Details
Azido-PEG5-azide
MBS3615508-01 50 mg

Azido-PEG5-azide

Sign In for Pricing
View Details