Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBCEL Peptide - C-terminal region

TBCEL Peptide - C-terminal region

Product Specifications

Product Name Alternative

El, FLJ14177, LRRC35, MGC10233

UniProt

Q5QJ74

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBCEL Rabbit Polyclonal Antibody (orb586579) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689928

Preservative

Lyophilized powder

AA Sequence

ISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Uncoupling Protein 3, Mitochondrial (UCP3)
SIPF810Hu01-01 10 µg

Recombinant Uncoupling Protein 3, Mitochondrial (UCP3)

Sign In for Pricing
View Details
Recombinant Uncoupling Protein 3, Mitochondrial (UCP3)
SIPF810Hu01-02 50 µg

Recombinant Uncoupling Protein 3, Mitochondrial (UCP3)

Sign In for Pricing
View Details
Recombinant Uncoupling Protein 3, Mitochondrial (UCP3)
SIPF810Hu01-03 200 µg

Recombinant Uncoupling Protein 3, Mitochondrial (UCP3)

Sign In for Pricing
View Details
Recombinant Uncoupling Protein 3, Mitochondrial (UCP3)
SIPF810Hu01-04 1 mg

Recombinant Uncoupling Protein 3, Mitochondrial (UCP3)

Sign In for Pricing
View Details
Recombinant Uncoupling Protein 3, Mitochondrial (UCP3)
SIPF810Hu01-05 5 mg

Recombinant Uncoupling Protein 3, Mitochondrial (UCP3)

Sign In for Pricing
View Details
Tuberin/TSC2 (Phospho-Ser939) Antibody
MBS8504016-01 0.1 mg

Tuberin/TSC2 (Phospho-Ser939) Antibody

Sign In for Pricing
View Details