TMED2 Peptide - middle region
TMED2 Peptide - middle region
Product Specifications
Product Name Alternative
FLJ21323, P24A, RNP24
UniProt
Q15363
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMED2 Rabbit Polyclonal Antibody (orb586580) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006806
Preservative
Lyophilized powder
AA Sequence
SNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVAMTAV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
039772-Biotin 200 µL
PCOTH, ID (PCOTH, Protein PCOTH, Prostate collagen triple helix protein) (Biotin) discontinued
Sign In for Pricing
View Details 
ARP7835-01 10 µg
Recombinant Human GYPA / CD235a / Glycophorin A Protein (His tag)
Sign In for Pricing
View Details ARP7835-02 50 µg
Recombinant Human GYPA / CD235a / Glycophorin A Protein (His tag)
Sign In for Pricing
View Details ARP7835-03 100 µg
Recombinant Human GYPA / CD235a / Glycophorin A Protein (His tag)
Sign In for Pricing
View Details ARP7835-04 1 mg
Recombinant Human GYPA / CD235a / Glycophorin A Protein (His tag)
Sign In for Pricing
View Details