Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMED2 Peptide - middle region

TMED2 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ21323, P24A, RNP24

UniProt

Q15363

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMED2 Rabbit Polyclonal Antibody (orb586580) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006806

Preservative

Lyophilized powder

AA Sequence

SNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVAMTAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cadherin-17 Antibody (rCDH17/8514) [PerCP]
NBP3-20889PCP 0.1 mL

Mouse Monoclonal Cadherin-17 Antibody (rCDH17/8514) [PerCP]

Sign In for Pricing
View Details
NSL1 Human Recombinant
rAP-3986 1 Each

NSL1 Human Recombinant

Sign In for Pricing
View Details
Monoclonal DIS3L2 Antibody, Clone: 6C7B2
APR15742G 0.1ml

Monoclonal DIS3L2 Antibody, Clone: 6C7B2

Sign In for Pricing
View Details
RGD1308874 CRISPRa sgRNA lentivector (set of three targets)(Rat)
39045126 3x 1.0µg DNA

RGD1308874 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Proban
TRC-P754500-1G 1 g

Proban

Sign In for Pricing
View Details
Lentiviral mouse Zik1 shRNA (UAS) - Lentiviral mouse Zik1 shRNA (UAS, iRFP) (25)
GTR15203726 1 Vial

Lentiviral mouse Zik1 shRNA (UAS) - Lentiviral mouse Zik1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details