Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAT2 Peptide - C-terminal region

ADAT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DEADC1, DKFZp686L1118, FLJ44213, TAD2, dJ20N2, dJ20N2.1

UniProt

Q7Z6V5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADAT2 Rabbit Polyclonal Antibody (orb326609) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872309

Preservative

Lyophilized powder

AA Sequence

NIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKEC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ASFV Ken-168 Protein (aa 1-136)
VAng-0903Lsx-1mg 1 mg

Recombinant ASFV Ken-168 Protein (aa 1-136)

Sign In for Pricing
View Details
MGST3 Double Nickase Plasmid (m2)
sc-426029-NIC-2 20 µg

MGST3 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
APOL2 Knockout NCI-H1299 Polyclonal Cells
ARG30381 1 Million

APOL2 Knockout NCI-H1299 Polyclonal Cells

Sign In for Pricing
View Details
Recombinant Oceanobacillus iheyensis Glucose-1-phosphate adenylyltransferase (glgC)
MBS1304442-01 0.02 mg (E-Coli)

Recombinant Oceanobacillus iheyensis Glucose-1-phosphate adenylyltransferase (glgC)

Sign In for Pricing
View Details
Recombinant Oceanobacillus iheyensis Glucose-1-phosphate adenylyltransferase (glgC)
MBS1304442-02 0.02 mg (Yeast)

Recombinant Oceanobacillus iheyensis Glucose-1-phosphate adenylyltransferase (glgC)

Sign In for Pricing
View Details
Recombinant Oceanobacillus iheyensis Glucose-1-phosphate adenylyltransferase (glgC)
MBS1304442-03 0.1 mg (E-Coli)

Recombinant Oceanobacillus iheyensis Glucose-1-phosphate adenylyltransferase (glgC)

Sign In for Pricing
View Details