Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAT2 Peptide - N-terminal region

ADAT2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DEADC1, DKFZp686L1118, FLJ44213, TAD2, dJ20N2, dJ20N2.1

UniProt

Q7Z6V5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADAT2 Rabbit Polyclonal Antibody (orb326610) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872309

Preservative

Lyophilized powder

AA Sequence

AKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-Arg (Pmc) Wang Resin LL
HLL0751501303.1G 1 g

Fmoc-Arg (Pmc) Wang Resin LL

Sign In for Pricing
View Details
PYCR1 (NM_001282281) Human Tagged ORF Clone
RG237616 10 µg

PYCR1 (NM_001282281) Human Tagged ORF Clone

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2641), Biotin conjugate, 0.1mg/mL
BNCB2641-500 1x 500 µL

Prolactin (Pituitary Tumor Marker) (PRL/2641), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lansoprazole Sulfone N-Oxide
TRC-L175030-25MG 25 mg

Lansoprazole Sulfone N-Oxide

Sign In for Pricing
View Details
RPL8 Rabbit Polyclonal Antibody
TA365365 100 µL

RPL8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mini Dry Bath Incubator BDMI-104
BDMI-104 1 Unit

Mini Dry Bath Incubator BDMI-104

Sign In for Pricing
View Details