Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAT2 Peptide - N-terminal region

ADAT2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DEADC1, DKFZp686L1118, FLJ44213, TAD2, dJ20N2, dJ20N2.1

UniProt

Q7Z6V5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADAT2 Rabbit Polyclonal Antibody (orb326610) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872309

Preservative

Lyophilized powder

AA Sequence

AKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNAL Rabbit Polyclonal Antibody
AP01477PU-N 100 µg

GNAL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS520345 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
CIRBP Human Gene Knockout Kit (CRISPR)
KN201639BN 1 Kit

CIRBP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(17α)-3,3-[1,2-Ethanediylbis(oxy)]-17-hydroxy-19-norpregna-5(10),9(11)-diene-21-nitrile
TRC-E890130-1G 1 g

(17α)-3,3-[1,2-Ethanediylbis(oxy)]-17-hydroxy-19-norpregna-5(10),9(11)-diene-21-nitrile

Sign In for Pricing
View Details
Fumaric Acid Monoethyl-d5 Ester
TRC-F500387-10MG 10 mg

Fumaric Acid Monoethyl-d5 Ester

Sign In for Pricing
View Details
PHF20L1 Mouse Monoclonal Antibody [Clone ID: OTI6G6]
CF809760 100 µg

PHF20L1 Mouse Monoclonal Antibody [Clone ID: OTI6G6]

Sign In for Pricing
View Details